Garage Sales

SHARE YOUR LOVE

Garage Sales in cannon falls, Minnesota

My List
Print
Alert me about new yard sales in this area
youreemail@domain.com

Find Yard Sales!

Near city or zip
Within
Items & Keywords
Post A Yard Sale, it's FREE!

More Yard Sales!

Minnesota Cities:

Multi Family Garage Sale

Save to my list | | Flag ▼
Wrong address
Wrong date
Duplicate
Not a yard sale
Where:
6592 295th Street East Cannon Falls, MN 55009
When:
Friday September 19 - Saturday September 20
Details:

Multi-Family Moving/Garage Sale Friday Sept. 19th 8:00am - 6:00pm and Saturday Sept. 20th 8:00am - 4:00pm. 6592 295th St. E (Dakota County 88) Cannon Falls MN (2) 2004 Geely Mopeds, Acra RF-30 Bench Top Milling machine with stand and tooling, Enco 110-2075 Bench Top Lathe with stand and tooling, Tile Cutter, Router, Fishing items, many Household items, Clothing from new born to adult, Books, Antique rocking chair, Antiques and collectables, HP copier, Play Station games & guitars, Singer Sew Mate 5400 sewing machine (only used 6 months). Many craft items including Fabric, Jewelry making supplies, Needlework kits, lots of Rubber stamps and Scrapbooking papers, and so much more.

People got here by searching for:
kenyon mn garage sales - garage sales jordan mn - cannon falls city wide garage sale - teaching materials garage sale mn - garage sales mn august 27 - cannon falls citywide garage sales 2011 - city wide garage sales cannon falls mn 2011 - zimmerman mn garage sales - rumage northfield mn - cannonfallscitywidegaragesaleseptember - cannon falls mn. garage sales - citywide garage sales twin cities mn - garage sales - garage sales near northfield mn - apple valley garage sales -